#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5tl6_B_1_C_1

Protein Model on 5tl6_B_1_C_1 (TEMPLATE: 5tl6 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (D) polymer(polypeptide(L)) [312 aa] Replicase polyprotein 1ab :R1AB_CVHSA
2 b C 1 (C) polymer(polypeptide(L)) [79 aa] Ubiquitin-like protein ISG15 :ISG15_HUMAN 1669W 1672N 1674C 1675Y 1725L 1726G 1727D 1729R 1730E 1766E 1771M 1786P 1788T(V) 1811P 1827Y 1831Y 1832Q 1833C 1834G 1835H 1836Y 1864T (identity: 95.5 %/83.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5tl6_B_1 identity=83.0%
queryA      1567:TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTS:1666
                :********** ***** ***************************  ****** *** ***** ******** * ***************** *** ****:
5tl6_B_1       8:TIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTS: 107
SecStr          : EEEEEESSSSSEEEEEE TTS HHHHTSSEESSSSB TTS   GGGTT EEEE   STTTTHHHHHHH    SSHHHHHHHHHHHHTT    EETTEE :    
ExpBur          :eeebbbbbbeeeeeeeebeeeebbeeeeeebbbebeebbeeebeeebeeeebbbeeeeeebeebbeebbeeeeeebbeebbebbeebeebebeebeebbb:    

queryA      1667:IKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVE:1766
                :**********   ** *** * *** **** ******** *********** **************  * ***** * ********* ***  *** ***:
5tl6_B_1     108:IKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVE: 207
SecStr          :  S TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHHT  HHHHHHHHHHHT  TT    HHHHHHHHHHSB  TT EEEEEEEETTTEEEEEEEETHH:    
ExpBur          :beeeeebbbbbbbbbbbbbbebebebebbeebbeebeebebbbbbbbbbbbbebeeeeeeebeebbeebbeebebeebebbbbbebeeeeeeeeeeeebe:    
Contact         :  b  b bb                                                 bbb bb                                   b

queryA      1767:AVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV:1866
                :**********   * ** *** **  ** ******* ********* * *  *** ** *********** *** ***** **** *** ****** ***:
5tl6_B_1     208:AVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDV: 307
SecStr          :HHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEE  TTS SEEEEEEE SSSEEEEEEEESSSEEEEETTEEEEES  EEEEEEE:    
ExpBur          :bbbbeebbbbeebbeebeeebeeeeebebbbebbebebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebbbbbbeebbbebebeeeeeeeebebebbbb:    
Contact         :    b              b b                      b               b   bbbbbb                           b  

queryA      1867:FYKENSYTTTIK:1878
                :**** *******:
5tl6_B_1     308:FYKETSYTTTIK: 319
SecStr          :EEE SEEE    :    
ExpBur          :bbebeebebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123