#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5tl7_B_1_A_1

Protein Model on 5tl7_B_1_A_1 (TEMPLATE: 5tl7 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [316 aa] Replicase polyprotein 1ab :R1AB_CVHSA
2 b A 1 (A) polymer(polypeptide(L)) [77 aa] Ubiquitin-like protein ISG15 :ISG15_MOUSE 1639D 1669W 1672N 1674C 1675Y 1717Y 1719N 1725L 1726G 1727D 1729R 1730E 1733S(T) 1734Y(H) 1737Q 1766E 1771M 1786P 1811P 1827Y 1831Y 1832Q 1833C 1834G 1835H 1836Y 1864T (identity: 92.6 %/82.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5tl7_B_1 identity=82.9%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :** ********** ***** ***************************  ****** *** ***** ******** * ***************** *** *:
5tl7_B_1       5:EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGG: 104
SecStr          :   EEEEEEESSSS  EEEEEETTS HHHHHSSEEETTEE TTS   GGGTT EEEE    SSHHHHHHHHH    TTHHHHHHHHHHHHTTS   EETT:    
ExpBur          :eeeebebebbeebeeeeeeebebeebbeeeeebbbbbbeebbeeebeeebeeebbbbbeeeeeeeeebeeebebeeebbbbbbebbbbbbeebebeebee:    
Contact         :                                                                           b                        

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :*************   ** *** * *** **** ******** *********** **************  * ***** * ********* ***  *** :
5tl7_B_1     105:LTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLT: 204
SecStr          :EE   S TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHTT  TT    HHHHHHHHHTTBS TT EEEEEEEETTTEEEEEEEE:    
ExpBur          :bbbbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeeeebbbbbbbbbbbbebebeeeeebeebbeebbebbebeebebbbbbebeeeeeeeeebe:    
Contact         :     b  b bb                                         b b     bbb bb  bb  b                          

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :*************   * ** *** **  ** ******* ********* * *  *** ** *********** *** ***** **** *** ****** :
5tl7_B_1     205:GVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV: 304
SecStr          :THHHHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEEE SSSEEEEEEEESSSEEEEETTEEEEESEEEEEE:    
ExpBur          :ebebbbbeebbbbeebbeebeeebeeeeebebbbeebebebbbbbbeeeeeebeeeebebbbbbeeeeeeeebbbbbeeebbbebebeeeeeeeebebeb:    
Contact         :  b    b              b                        b               b   bbbbbb                           

queryA      1864:TDVFYKENSYTTTIK:1878
                :******* *******:
5tl7_B_1     305:TDVFYKETSYTTTIK: 319
SecStr          :EEEEEE SEEE    :    
ExpBur          :bbbbbebeeeebeee:    
Contact         :b                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123