Protein Model on 5wkj_A_1_A_2 (TEMPLATE: 5wkj )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) A 1 (A) polymer(polypeptide(L)) [302 aa] Orf1a protein :A0A1L2E0X0_9BETC
2 b A 2 (A) polymer(polypeptide(L)) [302 aa] Orf1a protein :A0A1L2E0X0_9BETC 3263Q(H) 3265G 3267R(V) 3268K 3269M 3270A(S) 3271F(H) 3272P 3273S 3274G 3277E 3385P 3386S(T) 3387G 3388V(T) 3389Y(F) 3400K 3401G 3402S 3404L 3432T(N) 3433G 3434V(T) 3546G 3547S 3548A(T) 3549L(M) 3561R(M) 3562Q 3565G (identity: 60.0 %/52.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5wkj_A_1 identity=52.0%
queryA      3263:QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANP:3359
                : **  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** ***:
5wkj_A_1       7:HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANP: 106
SecStr          :           HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS TTS SS  HHHHHHH  GGGEEEE   --- EE EEEEEEETTEEEEEESS  T:    
ExpBur          :ebebeeeeeebeebeebbbbbebeebebbbbbbeebbbbbbebbbeeeeeeebebeebeeebeeeebebeeee---eebebebeeeeebbbebebeeebe:    
Contact         :b b bbbbbbbb  b                                                                                     

queryA      3360:KTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGT:3459
                : ** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   *:
5wkj_A_1     107:STPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLT: 206
SecStr          :T  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS      :    
ExpBur          :eebeeeeeebeebeebbbbbbbebbeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeeeee:    
Contact         :                         bbbbb          bbb b                           bbb                         

queryA      3460:DTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD:3558
                :*    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* *:
5wkj_A_1     207:DKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED: 302
SecStr          :  B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB      HHHHH---HHHHHT  HHHHHHHHHHHH-H  TT  BTTBSS   SS HHH:    
ExpBur          :eeebbebbbbbbbbbbeeeeeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeeeebbbebbbebbbebe-eebeeeebeebeebebbbbbeb:    
Contact         :                                                                                       bbbb         

queryA      3559:VVRQCSGV:3566
                :*  *  **:
5wkj_A_1     303:VNMQIMGV: 310
SecStr          :HHHHHH  :    
ExpBur          :bbeeeeee:    
Contact         :  bb  b                                                                                             


Input Residue Numbers for Focused Sites

ex) 2,15,123