Protein Model on 5wkk_A_2_B_2 (TEMPLATE: 5wkk )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) A 2 (A) polymer(polypeptide(L)) [301 aa] Orf1a protein :A0A1L2E0X0_9BETC
2 b B 2 (A) non-polymer(PG4) TETRAETHYLENE GLYCOL 3269M 3270A(S) 3271F(H) 3561R(M) (identity: 25.0 %/52.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5wkk_A_2 identity=52.0%
queryA      3263:QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANP:3359
                : **  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** ***:
5wkk_A_2       7:HSGLVKMSHPSGDVEACMVQVTCGXMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHXXXXANLRVVGHAMQGTLLKLTVDVANP: 106
SecStr          :  S        HHHHTTEEEEEE - EEEEEEETTEEEEEGGGGS GGGTTS  HHHHHHH  GGGEEEE  ---- EE EEEEEEETTEEEEEESS  T:    
ExpBur          :ebebeeeeeebeebeebbbbbbbe-eebbbbbbeeebbbbbbbbbeeebeeebebeebbeebeeeebebebe----eebebeeeeeeebbbbbebeeebe:    
Contact         :      bbb                                                                                           

queryA      3360:KTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGT:3459
                : ** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   *:
5wkk_A_2     107:STPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLT: 206
SecStr          :T  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS      :    
ExpBur          :eebeeeeeebeebeebbbbbbeebbeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeeeee:    

queryA      3460:DTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD:3558
                :*    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* *:
5wkk_A_2     207:DKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED: 302
SecStr          :  B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHHT  HHHHHHHHHHHH-T  TT  BTTBSS   SS HHH:    
ExpBur          :ebebbebbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeebebebebbbebbbebe-eebeeeebeeeeebebebbbeb:    

queryA      3559:VVRQCSGV:3566
                :*  *  **:
5wkk_A_2     303:VNMQIMGV: 310
SecStr          :HHHHTT  :    
ExpBur          :bbeeeeee:    
Contact         :  b                                                                                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123