#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5wkm_A_1_B_1

Protein Model on 5wkm_A_1_B_1 (TEMPLATE: 5wkm )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [301 aa] Orf1a protein :A0A1L2E0X0_9BETC
2 b B 1 (A) non-polymer(N02) (1S,2S)-2-{[N-({[1-(tert-butoxycarbonyl)-4-ethylpiperidin-4-yl]oxy}carbonyl)-L-leucyl]amino}-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid 3403F 3404L 3405N(C) 3406G 3407S 3408C 3426H 3427H(Q) 3428M 3429E 3435H 3450D 3451R(K) (identity: 76.9 %/52.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5wkm_A_1 identity=52.0%
queryA      3263:QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANP:3359
                : **  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** ***:
5wkm_A_1       7:HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPXXQLSDPNYDALLISMTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANP: 106
SecStr          :  S        HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  --  SS  HHHHHHH  GGG EEE   --- EE EEEEEEETTEEEEEESS  T:    
ExpBur          :ebebeeeeeebeebeebbbbbebeebebbbbbbeeebbbbbbbbbe--eeeeeebeebbeebeeeebebebee---eebebebeeeeebbbebebeeebe:    

queryA      3360:KTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGT:3459
                : ** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   *:
5wkm_A_1     107:STPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLT: 206
SecStr          :T  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS      :    
ExpBur          :eebeeeeeebeebeebbbbbbeebbeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeeeee:    
Contact         :                                           bbbbbb                 bbbb     b              bb        

queryA      3460:DTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD:3558
                :*    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* *:
5wkm_A_1     207:DKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED: 302
SecStr          :  B HHHHHHHHHHHHTTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHH   HHHHHHHHHHHH-H   S  BTTBSS   SS HHH:    
ExpBur          :eeebbbbbbbbbbbbbebeeeebeeeeebeeeebbebbeeeebbebeeeebbee---bbeeeebbbebbbebbbebe-eebeeeebeeeeebebbbbbeb:    

queryA      3559:VVRQCSGV:3566
                :*  *  **:
5wkm_A_1     303:VNMQIMGV: 310
SecStr          :HHHHHH  :    
ExpBur          :bbeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123