#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5y3q_A_1_C_1

Protein Model on 5y3q_A_1_C_1 (TEMPLATE: 5y3q )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [317 aa] Replicase polyprotein 1a :R1A_CVHSA
2 b C 1 (A) non-polymer(BME) BETA-MERCAPTOETHANOL 1669W 1672N 1673N 1674C 1834G 1835H (identity: 100.0 %/82.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5y3q_A_1 identity=82.8%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :** ********** ***** ***************************  ****** *** ***** ******** * ***************** *** *:
5y3q_A_1       2:EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGG: 101
SecStr          :   EEEEEEESSSSS EEEEEETTS HHHHHSSEEETTEE TTS   GGGTT EEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTT    EETT:    
ExpBur          :eeeebebebbbbeeeeeeeebebeebbeeebeebbbebeebbeeebeeebeeeebbbeeeeeebeebbeebbeeeeeebbbebbebbeebeebebeebbe:    

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :*************   ** *** * *** **** ******** *********** **************  * ***** * ********* ***  *** :
5y3q_A_1     102:LTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLT: 201
SecStr          :EE     TT HHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHHT  TT    HHHHHHHHHTTBS TT EEEEEEEETTTEEEEEEEE:    
ExpBur          :bbbbeeeeebbbbbbbbbbbbbbebebebebbbebbeebeeeebbbbbbbbbbbbebebeeebebeebbeebbebbebeebebbbbbebeeeeeeeeeee:    
Contact         :     b  bbb                                                                                         

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :*************   * ** *** **  ** ******* ********* * *  *** ** *********** *** ***** **** *** ****** :
5y3q_A_1     202:GVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV: 301
SecStr          :THHHHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEE TTS SEEEEEEE SS EEEEEEEESSSEEEEETTEEEEES EEEEE:    
ExpBur          :bbebbbbeebbbbeebbeebeeeeeeeeebebbbebbebebbbbbbeeeeeebeeeebebbbbbeeeeeeeebbbbbeeeebbebebeeeeebeebebeb:    
Contact         :                                                                      bb                            

queryA      1864:TDVFYKENSYTTTI:1877
                :******* ******:
5y3q_A_1     302:TDVFYKETSYTTTI: 315
SecStr          :EEEEEE SEEE   :    
ExpBur          :bbbbbebeeeebee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123