#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6jij_B_1_E_1

Protein Model on 6jij_B_1_E_1 (TEMPLATE: 6jij )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (C) polymer(polypeptide(L)) [298 aa] Replicative polyprotein 1ab :Q66WN6_CVMA5
2 b E 1 (E) polymer(polypeptide(L)) [6 aa] 02J-ALA-VAL-LEU-PJE-010 3288T(M) 3304H 3317Y 3403F 3404L 3405N(C) 3406G 3408C 3426H 3427H(Q) 3428M(L) 3429E 3435H 3450D 3452Q 3453T(V) 3454A(V) (identity: 64.7 %/51.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6jij_B_1 identity=51.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :**  **  *  *** * * ** *  ********* *********   **  * *  ** *     * *  *   * *    ** * * * *   ** ***:
6jij_B_1       1:SGIVKMVSPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICS--DMTDPDYPNLLCRVTSSDFCVMSGRMSLTVMSYQMQGCQLVLTVTLQNPNTPK:  98
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S--S SS  HHHHGGG  GGGEEEEETTEEE EEE  EETTEEEEEESS  TT   :    
ExpBur          :eeeeeeeeeeeebeebbbbbbbeeeebbbbbbeeebbbbbbbbbe--eeeebebeeebeebebeebebbeeeeebebeeeeeeebbbbbbbeeebeeebe:    
Contact         :                        b               b            b                                              

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :* *    ** ** *** *** * *      *   ******* *******     * * * ***  ** ** * ***  ******  * *  *    * * :
6jij_B_1      99:YSFGVVKPGETFTVLAAYNGRPQGAFHVTLRSSHTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGNFYGPYRDAQVVQLPVQDYTQ: 198
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEE SSSEEEEEEEEEEEETTEEEEE TTS BSSS  SSSS        B :    
ExpBur          :eeebebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbeeeeebbebbbbbbbebeeebbbbbbbebebbeebebbeeebeeeeeeeb:    
Contact         :                                       bbbb b                 bbbb     b              b bbb         

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :**** ******  *   **       *  **  **         * *  *  *   **  *    *  *  *  *  *  ****   *** ** **  * :
6jij_B_1     199:TVNVVAWLYAAIFNRCNWFVQSDSCSLEEFNVWAMTNGFSSIKADLV--LDALASMTGVTVEQVLAAIKR-LHSGFQGKQILGSCVFEDELTPSDVYQQL: 295
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB      HH--HHHHHHHHT  HHHHHHHHHH-TTS   SS SSS SS      HHHHHHHH:    
ExpBur          :bebbbbbbbbbbeeebeebeeeeebeeeebeeebeeeebbebeeeee--beebbeebebebebbbbbbee-beeebeeeebeebeebebbbbbeebeebb:    

queryA      3564:SGV:3566
                : **:
6jij_B_1     296:AGV: 298
SecStr          :S  :    
ExpBur          :eee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123