#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6m0k_A_1_F_1

Protein Model on 6m0k_A_1_F_1 (TEMPLATE: 6m0k )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [304 aa] Replicase polyprotein 1ab :R1AB_SARS2
2 b F 1 (A) non-polymer(FJC) ~{N}-[(2~{S})-3-(3-fluorophenyl)-1-oxidanylidene-1-[[(2~{S})-1-oxidanylidene-3-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]propan-2-yl]amino]propan-2-yl]-1~{H}-indole-2-carboxamide 3304H 3312M 3403F 3404L 3405N 3406G 3407S 3408C 3426H 3427H 3428M 3429E 3435H 3449V 3450D 3451R 3452Q (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6m0k_A_1 identity=100.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :****************************************************************************************************:
6m0k_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TGGGGS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :                                        b       b                                                   

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :****************************************************************************************************:
6m0k_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEEB TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS          B :    
ExpBur          :eeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeeb:    
Contact         :                                       bbbbbb                 bbbb     b             bbbb           

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :****************************************************************************************************:
6m0k_A_1     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHT:    
ExpBur          :bbbbbbbbbbbbbeeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeebeebebbbbbebbeeeb:    

queryA      3564:SGVT:3567
                :****:
6m0k_A_1     301:SGVT: 304
SecStr          :TTT :    
ExpBur          :eeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123