#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6vxs_A_1_D_1

Protein Model on 6vxs_A_1_D_1 (TEMPLATE: 6vxs )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [167 aa] Non-structural protein 3 :R1AB_SARS2
2 b D 1 (A) non-polymer(NHE) 2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID 1055T 1056V 1113H 1140Q 1141H 1142E (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6vxs_A_1 identity=100.0%
queryA      1025:VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK:1124
                :****************************************************************************************************:
6vxs_A_1       3:VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK: 102
SecStr          :     S EESSSSEEEEES HHHHHHHH  SEEEEEE TT    SHHHHHHHHHTTTHHHHHHHHHHHHH S  TT EEEEE TTT SEEEEEE   GGG:    
ExpBur          :eeebeebeebeebbbbbebebbebbeebebebbbbebeeebebeeeebeebbeebeeebbeebeeebeeeeebebbeebebebeebbeebbbbbbbbeee:    
Contact         :                              bb                                                        b           

queryA      1125:GEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL:1191
                :*******************************************************************:
6vxs_A_1     103:GEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL: 169
SecStr          :T  TTHHHHHHHGGGGSSEEEE  SS GGG   HHHHHHHHHHH  SEEEEEE  HHHHHHHHHHH :    
ExpBur          :eeeeeebeebbebbbebebbbbbbbbeeebebeeeebbebbbebbeeebbbbbeeeeebeebbeebe:    
Contact         :               bbb                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123