#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6w2a_A_1_C_1

Protein Model on 6w2a_A_1_C_1 (TEMPLATE: 6w2a )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [302 aa] Replicase polyprotein 1a :R1A_CVHSA
2 b C 1 (A) non-polymer(VDJ) [4,4-bis(fluoranyl)cyclohexyl]methyl ~{N}-[(2~{S})-1-[[(1~{R},2~{S})-1-[bis(oxidanyl)-oxidanylidene-$l^{5}-sulfanyl]-1-oxidanyl-3-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]propan-2-yl]amino]-4-methyl-1-oxidanylidene-pentan-2-yl]carbamate 3304H 3312M 3403F 3405N 3407S 3408C 3426H 3427H 3428M 3429E 3431P 3435H 3450D 3451R 3452Q 3454A (identity: 100.0 %/95.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6w2a_A_1 identity=95.7%
queryA      3263:QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTP:3362
                : ********************************** ********** ****************** ******************** * ***** *****:
6w2a_A_1       7:HSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTP: 106
SecStr          :           HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  HHHHHS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  :    
ExpBur          :eeebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebeeeeeebbbeeeebeebbbebebeeebeebb:    
Contact         :                                         b       b                                                  

queryA      3363:KYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT:3462
                :********************************** ********************************************* *******************:
6w2a_A_1     107:KYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTT: 206
SecStr          :EEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B:    
ExpBur          :eeeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbebeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeee:    
Contact         :                                        b b bb                 bbbb b   b              bbb b        

queryA      3463:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ:3562
                :** **************************************************************** *****************  *************:
6w2a_A_1     207:ITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQ: 306
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHH:    
ExpBur          :bbbbbbbbbbbbbebeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeeeeebbbbbbbebbeeb:    

queryA      3563:CS:3564
                :**:
6w2a_A_1     307:CS: 308
SecStr          :H :    
ExpBur          :be:    


Input Residue Numbers for Focused Sites

ex) 2,15,123