#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6w61_B_1_I_1

Protein Model on 6w61_B_1_I_1 (TEMPLATE: 6w61 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [115 aa] Non-structural protein 10 :R1AB_SARS2
2 b I 1 (B) non-polymer(ZN) ZINC ION 4327C 4330C 4336H 4343C (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6w61_B_1 identity=100.0%
queryA      4271:AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVC:4370
                :****************************************************************************************************:
6w61_B_1      19:AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVC: 118
SecStr          :     HHHHHHHHHHTT        B    S S   SEESS    TTEEEEESGGG HHHHTT   SSGGG  SSTTSEEEEEGGGTT HHHHHHH  B :    
ExpBur          :eeeeebbeebeeebeeebeeeeebeeeeeeeeeebebebeeeebeeebbbbbbebbbbbeeeeeebeeeeeebebeeeebbbbeeeeebbbbbbbeeeeb:    
Contact         :                                                        b  b     b      b                           

queryA      4371:TVCGMWKGYGCSCDQ:4385
                :***************:
6w61_B_1     119:TVCGMWKGYGCSCDQ: 133
SecStr          :TTT SBTTTT  TT :    
ExpBur          :eeeebbeeeebeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123