Protein Model on 6w75_D_1_C_1 (TEMPLATE: 6w75 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) D 1 (D) polymer(polypeptide(L)) [115 aa] SARS-CoV-2 NSP10 :R1AB_SARS2
2 b C 1 (C) polymer(polypeptide(L)) [292 aa] SARS-CoV-2 NSP16 :R1AB_SARS2 4293N 4294C 4295V 4296K 4297M 4298L 4299C 4300T 4310V 4311T 4312P 4322G 4323G 4324A 4325S 4330C 4331R 4333H 4346K 4347G 4348K 4349Y (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6w75_D_1 identity=100.0%
queryA      4271:AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVC:4370
                :****************************************************************************************************:
6w75_D_1      21:AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVC: 120
SecStr          :     HHHHHHHHHHTT        B    S S   SEESS    TTEEEEESGGG HHHHHT   SSTT   SSTTSEEEEEGGGTT HHHHHHH  B :    
ExpBur          :eeeeebbeebeeebeeeeeebeebeeeeeeeeeebebebeeeebeeebbbbbbebbbbbbeeeeebeeeeeebebeeeebbbbeebeebbbbbbbeeeeb:    
Contact         :                      bbbbbbbb         bbb         bbbb    bb b            bbbb                     

queryA      4371:TVCGMWKGYGCSCDQ:4385
                :***************:
6w75_D_1     121:TVCGMWKGYGCSCDQ: 135
SecStr          :TTT SBTTBB  TT :    
ExpBur          :eeeebbeeeebeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123