#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6w9c_C_1_A_1

Protein Model on 6w9c_C_1_A_1 (TEMPLATE: 6w9c )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) C 1 (C) polymer(polypeptide(L)) [312 aa] Papain-like proteinase :R1A_SARS2
2 b A 1 (A) polymer(polypeptide(L)) [313 aa] Papain-like proteinase :R1A_SARS2 1831Y 1832Q 1833C (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6w9c_C_1 identity=100.0%
queryA      1567:TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTS:1666
                :****************************************************************************************************:
6w9c_C_1       4:TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTS: 103
SecStr          : EEEEEESSSSS EEEEE SSS HHHHHSSEEETTEE SSS   GGGTT EEEE   SHHHHHHHHHHH    TTHHHHHHHHHHHHTTS   EETTEE :    
ExpBur          :ebebebbbbeeeeeeeebeeeebbbeebeebbbebeebbeeebeeebeeeebbbeeeeeebeebbeebbeeeeeebbeebbebbeebeebebeebeebbb:    

queryA      1667:IKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVE:1766
                :****************************************************************************************************:
6w9c_C_1     104:IKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVE: 203
SecStr          :  S TTTHHHHHHHHHHHTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHTS  TTS   HHHHHHHHHTTB  TT EEEEEEE SSS EEEEEEETHH:    
ExpBur          :beeeeebbbbbbbbbbbbebebebebebbbebbeebeeeebbbbbbbbbbbbebebeeebebeebbeebbeebebeebebbbbbebeeeeeeeeeeeebe:    

queryA      1767:AVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV:1866
                :****************************************************************************************************:
6w9c_C_1     204:AVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV: 303
SecStr          :HH  BSBS HHHHHH B  EETTTEE EEEEEEEESSEEEEEEEEEEEEE TTS SEEEEEESSSSS EEEEEEESSSEEEEETTEEEEES EEEEEEEE:    
ExpBur          :bbbbeeebbbeebeebbeeeeeeeeebebbbeebebebbbbbbeeeeeebeeeebebbbbbeeeeeebebebbbbeeebbbbebeeeeeeeebebebbbb:    
Contact         :                                                                bbb                                 

queryA      1867:FYKENSYTTTIK:1878
                :************:
6w9c_C_1     304:FYKENSYTTTIK: 315
SecStr          :EEE S EE    :    
ExpBur          :bbebeebebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123