#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6wrh_A_1_I_1

Protein Model on 6wrh_A_1_I_1 (TEMPLATE: 6wrh )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [316 aa] Non-structural protein 3 :R1AB_SARS2
2 b I 1 (A) non-polymer(GOL) GLYCEROL 1727D 1827Y 1830N 1831Y 1836Y 1864T (identity: 100.0 %/99.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6wrh_A_1 identity=99.7%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :****************************************************************************************************:
6wrh_A_1       4:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG: 103
SecStr          :   EEEEEEESSSSS EEEEEETTS HHHHHSSEEETTEE TT    GGGTT EEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTTS   EETT:    
ExpBur          :eeeebebbbbbbeeeeeeeebebeebbeeebeebbeebeebbeeebeeebeeeebbbeeeeeebeebbeebbeeeeeebbbebbebbeebeebebeebee:    

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :********** *****************************************************************************************:
6wrh_A_1     104:LTSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK: 203
SecStr          :EE     TT HHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHHT  TT    HHHHHHHHHHTB  TT EEEEEEEETTTEEEEEEEE:    
ExpBur          :bbbbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeeeebbbbbbbbbbbbeeebeeebebeebbbebbeebebeebebbbbeebeeeeeeeeeee:    
Contact         :                                                               b                                    

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :****************************************************************************************************:
6wrh_A_1     204:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI: 303
SecStr          :THHHHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEE TTS SEEEEEEEETTEEEEEEEEESSSEEEEETTEEEEESSEEEEE:    
ExpBur          :bbebbbbeebbbbeebbebbeeebeeeeebeebbbbbebebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebebbbbeebbbbbebeeeeeeeebebbb:    
Contact         :                                                               b  bb    b                           

queryA      1864:TDVFYKENSYTTTIK:1878
                :***************:
6wrh_A_1     304:TDVFYKENSYTTTIK: 318
SecStr          :EEEEEE SEEE    :    
ExpBur          :bbbbbebeeeebeee:    
Contact         :b                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123