#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6wuu_A_1_E_1

Protein Model on 6wuu_A_1_E_1 (TEMPLATE: 6wuu )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [318 aa] papain-like protease :R1AB_SARS2
2 b E 1 (G) polymer(polypeptide(L)) [5 aa] VIR250 1669W 1672N 1674C 1675Y 1725L 1726G 1727D 1771M 1810P 1811P 1827Y 1831Y 1832Q 1833C 1834G 1835H 1836Y 1864T (identity: 100.0 %/99.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6wuu_A_1 identity=99.7%
queryA      1562:LREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQV:1661
                : ***************************************************************************************************:
6wuu_A_1       1:MREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQV: 100
SecStr          :     EEEEEEESSSSS EEEEEETTS SHHHHSSEEETTEE TTS   GGGTT EEEE S SHHHHHHHHHHHS   HHHHHHHHHHHHHHTTS   EE:    
ExpBur          :eeeeeebebebbbbeeeeeeeebbbeebbeeebeebbbebeebeeeebeeebeeeebbbebeeeebeebbeebbeeeeeebbeebbebbeebeebebeeb:    

queryA      1662:NGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTT:1761
                :****************************************************************************************************:
6wuu_A_1     101:NGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTT: 200
SecStr          :TTEE   S TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHHT  HHHHHHHHHHTT  TTS   HHHHHHHHHHTB  TT EEEEEEE SSS EEEEE:    
ExpBur          :eebbbbeeeeebbbbbbbbbbbbbbebebebebbbebbeebeeeebbebbbbbbbbbeeebeeeeebeebbeebbeebebeebebbbbeebeeeeeeeee:    
Contact         :       b  b bb                                                 bbb                                  

queryA      1762:LKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKG:1861
                :****************************************************************************************************:
6wuu_A_1     201:LKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKG: 300
SecStr          :EEGGGGTEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEE TTS SEEEEEEE SSSEEEEEEEESSSEEEEETTEEEEESSEEE:    
ExpBur          :eebeebbbbeebbbbeebbebbeeeeeeeeebbbebeebebebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebebbbbeeebbbbebeeeeeeeebeb:    
Contact         :         b                                      bb               b   bbbbbb                         

queryA      1862:PITDVFYKENSYTTTIKP:1879
                :******************:
6wuu_A_1     301:PITDVFYKENSYTTTIKP: 318
SecStr          :EEEEEEEE SEEE SS  :    
ExpBur          :bbbbbbbebeebeeeeee:    
Contact         :  b                                                                                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123