#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6wuu_B_1_K_1

Protein Model on 6wuu_B_1_K_1 (TEMPLATE: 6wuu )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [321 aa] papain-like protease :R1AB_SARS2
2 b K 1 (B) non-polymer(MG) MAGNESIUM ION 1737Q (identity: 100.0 %/98.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6wuu_B_1 identity=98.8%
queryA      1562:LREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQV:1661
                : ***************************************************************************************************:
6wuu_B_1       1:MREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQV: 100
SecStr          :     EEEEEEESSSSS EEEEEETTS STTTTSSEEETTEE TTS   GGGTT EEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTTS   EE:    
ExpBur          :eeeeeebebebbbbeeeeeeeebebeebbeeebeebbbeeeebeeeebeeebeeeebebebeeeebeebbeebbeeeeeebbeebbebbeebeebebeeb:    

queryA      1662:NGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTT:1761
                :****************************************************************************************************:
6wuu_B_1     101:NGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTT: 200
SecStr          :TTEE     TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHHT  HHHHHHHHHHTT  TT    HHHHHHHHHHTBS TT EEEEEEEETTTEEEEEE:    
ExpBur          :eebbbbeeeeebbbbbbbbbbbbebebebebebbbebbeebeeeebbebbbbbbbbbeeeeeeeeebeebbbebbeebebeebebbbbebbeeebbeeee:    
Contact         :                                                                           b                        

queryA      1762:LKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKG:1861
                :****************************************************************************************************:
6wuu_B_1     201:LKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKG: 300
SecStr          :EEGGGGSEEES S HHHHHH EEEE SSSSEEEEEEEEEESSEEEEEEEEEEEEE TTS SEEEEEEE SSSEEEEEEEESSSEEEEETTEEEEES EEE:    
ExpBur          :eebbebbbbeebbbbeebbebbeeeeeeeeebebbbbebebebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebebbbbeebbbbbebeeeeeeeebeb:    

queryA      1862:PITDVFYKENSYTTTIKPVTY:1882
                :******************   :
6wuu_B_1     301:PITDVFYKENSYTTTIKPLEH: 321
SecStr          :EEEEEEEE SEEE        :    
ExpBur          :ebbbbbbebeebebeeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123