#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6wuu_C_1_G_1

Protein Model on 6wuu_C_1_G_1 (TEMPLATE: 6wuu )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:3]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) C 1 (C) polymer(polypeptide(L)) [317 aa] papain-like protease :R1AB_SARS2
2 b G 1 (I) polymer(polypeptide(L)) [5 aa] VIR250 1672N 1674C 1675Y 1725L 1726G 1727D 1771M 1810P 1811P 1827Y 1831Y 1832Q 1833C 1834G 1835H 1836Y (identity: 100.0 %/99.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6wuu_C_1 identity=99.7%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :****************************************************************************************************:
6wuu_C_1       3:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG: 102
SecStr          :   EEEEEEESSSSS EEEEEETTS HHHHHSSEEETTEE TTS   GGGTT EEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTTS   EETT:    
ExpBur          :eeeebebebbbbeeeeeeeebbbeebbeeebeebbbeeeebbeeebeeebeeeebebeeeeeebeebbeebbeeeeeebbeebbebbeebeebebeebee:    

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :****************************************************************************************************:
6wuu_C_1     103:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK: 202
SecStr          :EE     TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHHT  HHHHHHHHHHTT  TT    HHHHHHHHHHTB  TT EEEEEEEETTTEEEEEEEE:    
ExpBur          :bbbbeeeeebbbbbbbbbbbbbbebebebebbbebbeebeeeebbebbbbbbbbbeeeeeeeeebeebbbebbebbebeebebbbbeebeeeeeeeeeee:    
Contact         :        b bb                                                 bbb                                    

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :****************************************************************************************************:
6wuu_C_1     203:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI: 302
SecStr          :GGGGSEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEE TTS SEEEEEEE SSSEEEEEEEESSSEEEEETTEEEEESSEEEEE:    
ExpBur          :bbebbbbeebbebeebbebbeeeeeeeeebebbbeebebebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebebbbbeeebbbbbbeeeeeeeebebbb:    
Contact         :       b                                      bb               b   bbbbbb                           

queryA      1864:TDVFYKENSYTTTIKPV:1880
                :**************** :
6wuu_C_1     303:TDVFYKENSYTTTIKPL: 319
SecStr          :EEEEEE S EE S    :    
ExpBur          :bbbbbebeebebeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123