#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6wx4_A_1_B_1

Protein Model on 6wx4_A_1_B_1 (TEMPLATE: 6wx4 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (D) polymer(polypeptide(L)) [320 aa] Non-structural protein 3 :R1AB_SARS2
2 b B 1 (I) polymer(polypeptide(L)) [5 aa] VIR251 1669W 1672N 1674C 1675Y 1725L 1726G 1727D 1810P 1811P 1827Y 1831Y 1832Q 1833C 1834G 1835H 1836Y (identity: 100.0 %/99.1 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6wx4_A_1 identity=99.1%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :****************************************************************************************************:
6wx4_A_1       3:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG: 102
SecStr          :   EEEEEEESSSSS EEEEEETTS HHHHHSSEEETTEE TTS   GGGTT EEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTTS   EETT:    
ExpBur          :eeeebebebbbbeeeeeeeebebeebbeeeeeebbbebeebbeeebeeebeeeebbbbbeeeebeebbeebbeeeeeebbbebbebbeebeebebeebee:    

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :****************************************************************************************************:
6wx4_A_1     103:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK: 202
SecStr          :EE   S TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHHT  TT    HHHHHHHHHTTB  TT EEEEEEEETTTEEEEEEEE:    
ExpBur          :bbbbeeeeebbbbbbbbbbbbebebebebebbeebbeebeeeebbebbbbbbbbbebebeeeeebeebbbebbebbebeebebbbbbbbeeebeeeeebe:    
Contact         :     b  b bb                                                 bbb                                    

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :****************************************************************************************************:
6wx4_A_1     203:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI: 302
SecStr          :THHHHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEE TTS SEEEEEEEETTEEEEEEEEESSSEEEEETTEEEEES EEEEE:    
ExpBur          :eeebbbbeebbbbeebbebbeeebeeeeebeebbbebebebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebebbbbeebbbbbebeeeeeeeebebbb:    
Contact         :                                              bb               b   bbbbbb                           

queryA      1864:TDVFYKENSYTTTIKPVTY:1882
                :****************   :
6wx4_A_1     303:TDVFYKENSYTTTIKPLEH: 321
SecStr          :EEEEEE SEEE     S  :    
ExpBur          :bbbbbebeebebeeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123