#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6wzu_A_1_G_1

Protein Model on 6wzu_A_1_G_1 (TEMPLATE: 6wzu )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [315 aa] Non-structural protein 3 :R1AB_SARS2
2 b G 1 (A) non-polymer(CL) CHLORIDE ION 1573T 1574V 1575D 1578N 1580H 1630E (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6wzu_A_1 identity=100.0%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :****************************************************************************************************:
6wzu_A_1       4:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG: 103
SecStr          :   EEEEEEESSSSS EEEEEETTS HHHHHSSEEETTEE TTS   GGGTT EEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTTS   EETT:    
ExpBur          :eeeebebbbbbbeeeeeeeebebeebbeeebeebbeebeebbeeebeeebeeeebbbeeeeeebeebbeebbeeeeeebbbebbebbeebeebebeebee:    
Contact         :         bbb  b b                                                 b                                 

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :****************************************************************************************************:
6wzu_A_1     104:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK: 203
SecStr          :EE     TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHTT  TT    HHHHHHHHHHTB  TT EEEEEEEETTTEEEEEEEE:    
ExpBur          :bbbbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeeeebbbbbbbbbbbbeeebeeebebeebbbebbeebebeebebbbbeebeeeeeeeeeee:    

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :****************************************************************************************************:
6wzu_A_1     204:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI: 303
SecStr          :THHHHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEEE SS EEEEEEEESSSEEEEETTEEEEESEEEEEE:    
ExpBur          :bbebbbbeebbbbeebbebbebebeeeeebeebbbbbebebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebebbbbeebbbbbbbeeeeeeeebebbb:    

queryA      1864:TDVFYKENSYTTTIK:1878
                :***************:
6wzu_A_1     304:TDVFYKENSYTTTIK: 318
SecStr          :EEEEEE SEEE    :    
ExpBur          :bbbbbebeeeebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123