#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xa4_A_1_B_1

Protein Model on 6xa4_A_1_B_1 (TEMPLATE: 6xa4 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [304 aa] main protease :R1AB_SARS2
2 b B 1 (B) polymer(polypeptide(L)) [4 aa] inhibitor UAW241 3304H 3312M 3403F 3404L 3405N 3406G 3407S 3408C 3426H 3427H 3428M 3429E 3450D 3452Q 3453T (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6xa4_A_1 identity=100.0%
queryA      3265:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKY:3364
                :****************************************************************************************************:
6xa4_A_1       4:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKY: 103
SecStr          :         HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TGGGGS  HHHHHHH  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT   E:    
ExpBur          :ebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebee:    
Contact         :                                       b       b                                                    

queryA      3365:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTIT:3464
                :****************************************************************************************************:
6xa4_A_1     104:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTIT: 203
SecStr          :EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B H:    
ExpBur          :eeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbebeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebebb:    
Contact         :                                      bbbbbb                 bbbb                    b bb           

queryA      3465:VNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS:3564
                :****************************************************************************************************:
6xa4_A_1     204:VNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS: 303
SecStr          :HHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHHH:    
ExpBur          :bbbbbbbbbbbeeeeeebebeeebeeeebeebbeeeebeebeeeebeebeebbeeeebebeebbbbbeebbeeebeeeebeebeeeebbbbbebbebeee:    

queryA      3565:GVTF:3568
                :****:
6xa4_A_1     304:GVTF: 307
SecStr          :T   :    
ExpBur          :eeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123