#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xa9_E_1_F_1

Protein Model on 6xa9_E_1_F_1 (TEMPLATE: 6xa9 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:3]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) E 1 (E) polymer(polypeptide(L)) [307 aa] Papain-like protease :R1AB_SARS2
2 b F 1 (F) polymer(polypeptide(L)) [79 aa] ISG15 CTD-propargylamide :ISG15_HUMAN 1669W 1672N 1673N 1674C 1675Y 1720K 1724E 1725L 1726G 1727D 1729R 1730E 1733S 1734Y 1737Q 1766E 1827Y 1831Y 1832Q 1833C 1834G 1835H 1836Y 1864T (identity: 100.0 %/99.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6xa9_E_1 identity=99.4%
queryA      1568:IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSI:1667
                :**********************************************  ****************************************************:
6xa9_E_1       8:IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHXXKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSI: 107
SecStr          : EEEEESSSSS EEEE  TTS HHHHHSSEEETTEE TTS   TT -- EEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTTS   EETTEE  :    
ExpBur          :eebebbbbeeeeeeeebeeebebeeeeeebbbebeebeeeebeeee--eebbbbeeeeebbebbeebbeeeeeebbeebbebbeebeebebeebeebbbb:    

queryA      1668:KWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEA:1767
                :****************************************************************************************************:
6xa9_E_1     108:KWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEA: 207
SecStr          : S TT HHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHHT  TT    HHHHHHHHHHTB  TT EEEEEEEETTTEEEEEEEETHHH:    
ExpBur          :eeeeebbbbbbbbbbbbbbebebebebbbebbeebeeeebbebbbbbbbbbebebeeeeebeebbeebbeebebeebbbbbbeebeeeeeeeeeeebbeb:    
Contact         : b  bbbb                                            b   bbbb bb  bb  b                            b 

queryA      1768:VMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF:1867
                :****************************************************************************************************:
6xa9_E_1     208:VMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF: 307
SecStr          :HEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEEEETTEEEEEEEEESSSEEEEETTEEEEESEEEEEEEEEE:    
ExpBur          :bbbeebbbbeebeebbebeeeeeeebeeebbbbebebbbbbbeeeeeebeeeebebbbbbeeeeeeeebebbbbeebbbbbebeeeeeeeebebebbbbb:    
Contact         :                                                           b   bbbbbb                           b   

queryA      1868:YKENSYTTT:1876
                :*********:
6xa9_E_1     308:YKENSYTTT: 316
SecStr          :EE SEEE  :    
ExpBur          :bebeebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123