#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xaa_A_1_B_1

Protein Model on 6xaa_A_1_B_1 (TEMPLATE: 6xaa )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [309 aa] Papain-like protease :R1AB_SARS2
2 b B 1 (B) polymer(polypeptide(L)) [76 aa] Ubiquitin-propargylamide :J3QS39_HUMAN 1672N 1673N 1674C 1675Y 1724E 1725L 1726G 1727D 1729R 1730E 1762L 1766E 1770Y 1771M 1788T 1795K 1810P 1827Y 1831Y 1832Q 1833C 1834G 1835H 1836Y 1864T (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6xaa_A_1 identity=100.0%
queryA      1568:IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSI:1667
                :****************************************************************************************************:
6xaa_A_1       8:IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSI: 107
SecStr          : EEEEESSSSS EEEE  TTS HHHHHSSEEETTEE TT    GGGTT EEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTTS   EETTEE  :    
ExpBur          :eebebbbbeeeeeeeebeeebbbeeebeebbeebeebeeeebbeebeebebbbeeeeeebbebbeebbeeeeeebbbbbbebbeebeebebeebeebbbb:    

queryA      1668:KWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEA:1767
                :****************************************************************************************************:
6xaa_A_1     108:KWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEA: 207
SecStr          : S TT HHHHHHHHHHTTS   BSSHHHHHHHHHHHHT  HHHHHHHHHHTT  TT    HHHHHHHHHHTB  TT EEEEEEEETTTEEEEEEEETHHH:    
ExpBur          :eeeeebbbbbbbbbbbbbbebebebebbeebbeebeeeebbebbbbbbbbbebeeeeebebeebbeebbeebebeebebbbbeebeeeeeeeeeeebbeb:    
Contact         :    bbbb                                                bbbb bb                               b   b 

queryA      1768:VMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF:1867
                :****************************************************************************************************:
6xaa_A_1     208:VMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF: 307
SecStr          :HEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEEEETTEEEEEEEEESSSEEEEETTEEEEESEEEEEEEEEE:    
ExpBur          :bebeebbbbeebeebbeeebeeeeebebebbebbbebbbbbbeeeeeebeeeebebbbbbeeeeeeeebebbbbeebbbbbbbeeeeeeeebebbbbbbb:    
Contact         :  bb                b      b              b                b   bbbbbb                           b   

queryA      1868:YKENSYTTT:1876
                :*********:
6xaa_A_1     308:YKENSYTTT: 316
SecStr          :EE SEEE  :    
ExpBur          :bebeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123