#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xez_B_1_A_1

Protein Model on 6xez_B_1_A_1 (TEMPLATE: 6xez )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [186 aa] nsp8 :R1AB_SARS2
2 b A 1 (A) polymer(polypeptide(L)) [926 aa] nsp12 :R1AB_SARS2 4018S 4021K 4022R 4024K 4025V 4026T 4029M 4030Q 4036M 4037L 4039K 4042N 4046N 4052A 4055G 4056C 4057V 4058P 4059L 4060N 4061I 4062I 4063P 4064L 4067A 4069K 4070L 4071M 4072V 4073V 4075P 4104A 4125P 4127I (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6xez_B_1 identity=100.0%
queryA      3948:FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNN:4047
                :****************************************************************************************************:
6xez_B_1       7:FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNN: 106
SecStr          : TTSHHHHHHHHHHHHHHHHHHHT  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS HHHHHH:    
ExpBur          :eeeeebeeeeeeeeeebeeeeeeeeeeeeeeebeeeeeebeeebebbeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeebee:    
Contact         :                                                                      b  bb bbb  bb     bb b  b   b 

queryA      4048:IINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA:4133
                :**************************************************************************************:
6xez_B_1     107:IINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA: 192
SecStr          :HHHHSSSS   STHHHHHH     B  SSHHHHHHHS SSEEE SSSEEE   EEETTS B  TTT  GGG TTS S EEE  EE :    
ExpBur          :beeeeeeeeeeeeebeeebeeebebebeebeebeeebeeeebeeeeeebebeebbbeeeeebeeeebeeebeeebeeebebbbeee:    
Contact         :    b  bbbbbbbbbb  b bbbbb b                            b                    b b                    


Input Residue Numbers for Focused Sites

ex) 2,15,123