#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xez_B_1_F_1

Protein Model on 6xez_B_1_F_1 (TEMPLATE: 6xez )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [186 aa] nsp8 :R1AB_SARS2
2 b F 1 (F) polymer(polypeptide(L)) [596 aa] nsp13 :R1AB_SARS2 4001L 4004M 4005A 4009M 4012M 4013Y (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6xez_B_1 identity=100.0%
queryA      3948:FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNN:4047
                :****************************************************************************************************:
6xez_B_1       7:FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNN: 106
SecStr          : TTSHHHHHHHHHHHHHHHHHHHT  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS HHHHHH:    
ExpBur          :eeeeebeeeeeeeeeebeeeeeeeeeeeeeeebeeeeeebeeebebbeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeebee:    
Contact         :                                                     b  bb   b  bb                                  

queryA      4048:IINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA:4133
                :**************************************************************************************:
6xez_B_1     107:IINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA: 192
SecStr          :HHHHSSSS   STHHHHHH     B  SSHHHHHHHS SSEEE SSSEEE   EEETTS B  TTT  GGG TTS S EEE  EE :    
ExpBur          :beeeeeeeeeeeeebeeebeeebebebeebeebeeebeeeebeeeeeebebeebbbeeeeebeeeebeeebeeebeeebebbbeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123