#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xez_D_1_H_1

Protein Model on 6xez_D_1_H_1 (TEMPLATE: 6xez )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) D 1 (D) polymer(polypeptide(L)) [186 aa] nsp8 :R1AB_SARS2
2 b H 1 (T) polymer(polyribonucleotide) Template RNA 3985N (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6xez_D_1 identity=100.0%
queryA      3948:FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNN:4047
                :****************************************************************************************************:
6xez_D_1       7:FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNN: 106
SecStr          : TTSHHHHHHHHHHHHHHHHHHTT  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHS HHHHHHHHHHHHHHT  SHHHH:    
ExpBur          :eeeeebeeeeeebeeeeeeeeeeeeeeeeeeebeeebeebeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee:    
Contact         :                                     b                                                              

queryA      4048:IINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA:4133
                :**************************************************************************************:
6xez_D_1     107:IINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA: 192
SecStr          :HHHHHHTT  BSS    SSS EEEEEE  HHHHHHHEETTEEE SSSEEE    B TTS B  SSS  TTTGGGS S EEEEEEB :    
ExpBur          :eeebeeeebeeeeeebeeeeeebebbbeebebbeebbeeeebebbebebebeebebeeeeebeeebbeeeebeebeeebebbbeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123