#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xqt_B_1_D_1

Protein Model on 6xqt_B_1_D_1 (TEMPLATE: 6xqt )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_SARS2
2 b D 1 (B) non-polymer(NNA) (1R,2S,5S)-3-[N-({1-[(tert-butylsulfonyl)methyl]cyclohexyl}carbamoyl)-3-methyl-L-valyl]-N-{(1S)-1-[(1R)-2-(cyclopropyla mino)-1-hydroxy-2-oxoethyl]pentyl}-6,6-dimethyl-3-azabicyclo[3.1.0]hexane-2-carboxamide 3289T 3304H 3312M 3317Y 3404L 3405N 3406G 3407S 3408C 3426H 3427H 3428M 3429E 3430L 3431P 3448F 3449V 3450D 3451R 3452Q 3453T 3454A 3455Q (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6xqt_B_1 identity=100.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :****************************************************************************************************:
6xqt_B_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TGGGSS  HHHHHHT  GGGEEEEETTEEEEEEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeebebeebeebbbebebeeeebbbbbbeebbbbbbbbbbeeeeeeebebeeebeeeeeeebebeeeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :                         b              b       b    b                                              

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :****************************************************************************************************:
6xqt_B_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbeebeeebbbbbbbebebbeebebeeeeeeeeeeeeb:    
Contact         :                                        bbbbb                 bbbbbb                bbbbbbbb        

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :****************************************************************************************************:
6xqt_B_1     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHHT  TT  S    SSHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  SS  BTTBSS      HHHHHHHT:    
ExpBur          :bbbbbbbbbbbbeeeeeebbbeeebeeeebbebbeeeebeebeeeebeebeebeeebebebeebbbbbbebbeeebeeeebeeeeeeebbbbbebbebee:    

queryA      3564:SGVTFQ:3569
                :******:
6xqt_B_1     301:SGVTFQ: 306
SecStr          :TT    :    
ExpBur          :eeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123