#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6yva_A_1_B_1

Protein Model on 6yva_A_1_B_1 (TEMPLATE: 6yva )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [283 aa] Replicase polyprotein 1a :R1A_SARS2
2 b B 1 (C) polymer(polypeptide(L)) [155 aa] Ubiquitin-like protein ISG15 :ISG15_MOUSE 1625D 1629V 1632F 1633E 1638T 1640P 1669W 1672N 1674C(S) 1675Y 1719N 1725L 1726G 1727D 1729R 1730E 1733S 1734Y 1737Q 1766E 1771M 1811P 1827Y 1831Y 1832Q 1833C 1834G 1836Y 1864T (identity: 96.6 %/91.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6yva_A_1 identity=91.3%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :****************************************************************************************************:
6yva_A_1       1:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG: 100
SecStr          :    EEEEEESSSSS EEEEE S   TTTTT S EETTEE TT    TT SS EEE    SHHHHHHHHHHH    TTHHHHHHHHHHHHTTS   EETT:    
ExpBur          :eeeeeebebbbbeeeeeeeebeeebebeeebbebbeebeebeeeebeeebeebebbbbbeeeebeebbeebbebeeeebbbebbebbeebeebebeebee:    
Contact         :                                                             b   b  bb    b b                       

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :********** *************************************************************************           *****:
6yva_A_1     101:LTSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVXXXXXXXXXXXQTTLK: 200
SecStr          :EE     TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHTT  TT    HHHHHHHHHHTB  TT EE -----------   EE:    
ExpBur          :bbbbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeeeebbbbbbbbbbbbebebeeeeebeebbeebbeebebeebbbe-----------eeeee:    
Contact         :     b  b bb                                           b     bbb bb  bb  b                          

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :******************               *******************************************************************:
6yva_A_1     201:GVEAVMYMGTLSYEQFKKXXXXXXXXXXXXXXXLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI: 300
SecStr          :SGGGS  BS S STTTT ---------------   EESSEEEEEEEEEEEEE TTS SEEEEEEE SSSEEEEEEE SSS EEEETTEEE  SSEEEEE:    
ExpBur          :bbebbbeeeebeeebeee---------------eeebbbebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebebbbbeebbbbbebeeeeeeeebebbb:    
Contact         :  b    b                                       b               b   bbbb b                           

queryA      1864:TDVFYKENS:1872
                :*********:
6yva_A_1     301:TDVFYKENS: 309
SecStr          :EEEEEE   :    
ExpBur          :bbbbbebee:    
Contact         :b                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123