#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6ywk_E_1_CA_1

Protein Model on 6ywk_E_1_CA_1 (TEMPLATE: 6ywk )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:5]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) E 1 (E) polymer(polypeptide(L)) [172 aa] NSP3 macrodomain :R1AB_SARS2
2 b CA 1 (E) non-polymer(EPE) 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID 1060A 1061A 1062N 1066K 1068G 1069G 1072A 1150S 1151A 1153I 1154F (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6ywk_E_1 identity=100.0%
queryA      1025:VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK:1124
                :****************************************************************************************************:
6ywk_E_1       4:VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK: 103
SecStr          :TT   S EE SSSEEEEES HHHHHHHH  SEEEEE  TT    SHHHHHHHHHTTTHHHHHHHHHHHHH    TT EEEEE TTT SEEEEE    GGG:    
ExpBur          :eeebeebeebeebbbbbebebbebbeebebebbbbebebebebeeeebbebbeebeeebbeebeeeeeeeeebeebeebebebeebbeebbbbbbbbeee:    
Contact         :                                   bbb   b bb  b                                                    

queryA      1125:GEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM:1193
                :*********************************************************************:
6ywk_E_1     104:GEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM: 172
SecStr          :T  TTHHHHHHHGGGGSSEEEE  TT GGG   HHHHHHHHHHH  SEEEEEE  HHHHHHHHHHHHT :    
ExpBur          :eeeeeebeebbebbbeeebbbbbbbbeeebebeeeebbebbbebbebebbbbbeeeeebeebbeeeeee:    
Contact         :                         bb bb                                                                      


Input Residue Numbers for Focused Sites

ex) 2,15,123