#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6yyt_B_1_A_1

Protein Model on 6yyt_B_1_A_1 (TEMPLATE: 6yyt )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [186 aa] nsp8 :R1AB_SARS2
2 b A 1 (A) polymer(polypeptide(L)) [853 aa] nsp12 :R1AB_SARS2 4017R 4018S 4021K 4022R 4024K 4025V 4026T 4028A 4029M 4032M 4033L 4034F 4036M 4037L 4039K 4040L 4045L 4046N 4048I 4049I 4051N 4052A 4053R 4054D 4055G 4056C 4057V 4058P 4059L 4060N 4061I 4062I 4063P 4064L 4067A 4069K 4070L 4071M 4072V 4073V 4075P 4083T 4091Y 4127I (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6yyt_B_1 identity=100.0%
queryA      3948:FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNN:4047
                :****************************************************************************************************:
6yyt_B_1       9:FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNN: 108
SecStr          : TTSHHHHHHHHHHHHHHHHHHHT  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHS HHHHHH:    
ExpBur          :eeebebbeebeebeeebeebeeeeeeeeeeeeeeeeeeebeeeeeebbeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee:    
Contact         :                                                                     bb  bb bbb bb  bbb bb bb    bb 

queryA      4048:IINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA:4133
                :**************************************************************************************:
6yyt_B_1     109:IINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA: 194
SecStr          :HHHH SSS   STHHHHHH SEEEEEE SHHHHHHSS SSEEEETTEEEEEEEEE TTS B  TTT  STTTTTS SSEEEEEEE :    
ExpBur          :beeeeeeeeeeeeeeeeebeeebeeebeebeebeeebeeeebeeeebebebeebbbeeeeebeeeebeeeebeebeeebebbbeee:    
Contact         :bb bbbbbbbbbbbbbb  b bbbbb b       b       b                                   b                    


Input Residue Numbers for Focused Sites

ex) 2,15,123