#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6yyt_D_1_C_1

Protein Model on 6yyt_D_1_C_1 (TEMPLATE: 6yyt )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) D 1 (D) polymer(polypeptide(L)) [186 aa] nsp8 :R1AB_SARS2
2 b C 1 (C) polymer(polypeptide(L)) [73 aa] nsp7 :R1AB_SARS2 4025V 4026T 4029M 4030Q 4031T 4033L 4034F 4036M 4037L 4040L 4042N 4044A 4045L 4048I 4049I 4052A 4053R 4057V 4058P 4059L 4060N 4061I 4062I 4064L (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6yyt_D_1 identity=100.0%
queryA      3948:FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNN:4047
                :****************************************************************************************************:
6yyt_D_1       9:FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNN: 108
SecStr          : TTSHHHHHHHHHHHHHHHHHHHT  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSHHHHHHHHHHHHHHH  HHHHH:    
ExpBur          :eeebebbeebeebeeebeebeeeeeeeeeeeebeeeeeebeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeebeee:    
Contact         :                                                                             bb  bbb bb bb  b b bb  

queryA      4048:IINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA:4133
                :**************************************************************************************:
6yyt_D_1     109:IINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA: 194
SecStr          :HHHHHHHT  BSS    SSS EEEEEE SHHHHHHHEETTEEEETTEEEEEEEEE SS  B  STT STTTTTTS SSEEEEEEE :    
ExpBur          :eeebeeeebeeeeeebeeeeeebebbbeeeebbeebbeeeebebbebebebeebebeeeeebeeeebeeeebeebeeebebbbbee:    
Contact         :bb  bb   bbbbbb b                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123