#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 7jit_A_1_L_1

Protein Model on 7jit_A_1_L_1 (TEMPLATE: 7jit )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [314 aa] Papain-like protease :R1A_SARS2
2 b L 1 (A) non-polymer(ACT) ACETATE ION 1727D 1729R 1730E 1771M 1831Y (identity: 100.0 %/99.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:7jit_A_1 identity=99.7%
queryA      1565:VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGL:1664
                :****************************************************************************************************:
7jit_A_1       5:VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGL: 104
SecStr          :  EEEEEEESSSSS EEEEEETTS HHHHHSSEEETTEE TTS   GGGTT EEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTTS   EETTE:    
ExpBur          :eeebebebbbbeeeeeeeebebeebbeeebeebbbebeebbeeebeeebeeeebbbeeeeeebeebbeebbeeeeeebbbebbebbeebeebebeebeeb:    

queryA      1665:TSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKG:1764
                :********* ******************************************************************************************:
7jit_A_1     105:TSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKG: 204
SecStr          :E   S TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHHT  TT    HHHHHHHHHTTB  TT EEEEEEEETTTEEEEEEEET:    
ExpBur          :bbbeeeeebbbbbbbbbbbbbbebebebebbbebbeebeeeebbebbbbbbbbbebeeeeebebeebbeebbeebebeebebbbbeebeeeeeeeeeeeb:    
Contact         :                                                              b bb                                  

queryA      1765:VEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT:1864
                :****************************************************************************************************:
7jit_A_1     205:VEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT: 304
SecStr          :HHHHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEE TTS SEEEEEESSTTT EEEEEEESSSEEEEETTEEEEES EEEEEE:    
ExpBur          :bebbbbeebbebeebbebbebebeeeeebeebbbebebebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebebbbbeebbbbbebeeeeeeeebebebb:    
Contact         :      b                                                           b                                 

queryA      1865:DVFYKENSYTTTIK:1878
                :**************:
7jit_A_1     305:DVFYKENSYTTTIK: 318
SecStr          :EEEEE SEEE    :    
ExpBur          :bbbbebeebebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123