#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 7jiv_A_1_J_1

Protein Model on 7jiv_A_1_J_1 (TEMPLATE: 7jiv )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [312 aa] Papain-like protease :R1A_SARS2
2 b J 1 (A) non-polymer(CL) CHLORIDE ION 1636H (identity: 100.0 %/99.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:7jiv_A_1 identity=99.7%
queryA      1567:TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTS:1666
                :****************************************************************************************************:
7jiv_A_1       7:TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTS: 106
SecStr          : EEEEEESSSSS EEEEE SSS HHHHHSSEEETTEE TTS   GGGTT EEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTTS   EETTEE :    
ExpBur          :ebebebbbbeeeeeeeebeeeebbbeebeebbeebeebbeeebeeebeeeebbbeeeeeebeebbeebbeeeeeebbbebbebbeebeebebeebeebbb:    
Contact         :                                                                     b                              

queryA      1667:IKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVE:1766
                :******* ********************************************************************************************:
7jiv_A_1     107:IKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVE: 206
SecStr          :  S TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHHT  TT    HHHHHHHHHHTB  TT EEEEEEEETTTEEEEEEEETHH:    
ExpBur          :beeeeebbbbbbbbbbbbbbebebebebbbebbeebeeeebbebbbbbbbbbebeeeeebebeebbeebbeebebeebebbbbeebeeeeeeeeeeebbe:    

queryA      1767:AVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV:1866
                :****************************************************************************************************:
7jiv_A_1     207:AVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV: 306
SecStr          :HHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEESSTTT EEEEEEESSSEEEEETTEEEEESEEEEEEEEE:    
ExpBur          :bbbbeebbebeebbebbebebeeeeebeebbbebebebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebebbbbeebbbbbebeeeeeeeebebebbbb:    

queryA      1867:FYKENSYTTTIK:1878
                :************:
7jiv_A_1     307:FYKENSYTTTIK: 318
SecStr          :EEE SEEE S  :    
ExpBur          :bbebeeeebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123