#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 1lvo_D_3_E_2

Protein Model on 1lvo_D_3_E_2 (TEMPLATE: 1lvo )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:4]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) D 3 (D) polymer(polypeptide(L)) [301 aa] Replicase, hydrolase domain :R1AB_CVPPU
2 b E 2 (E) polymer(polypeptide(L)) [299 aa] Replicase, hydrolase domain :R1AB_CVPPU 48D(T) 49M(R) 50L(V) 184P(G) 185F(Y) 186V(E) 188R(Q) 189Q(P) 190T(S) 191A(M) 192Q (identity: 9.1 %/44.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1lvo_D_3 identity=44.9%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *   ** * *         * ***   ** ** :
1lvo_D_3       1:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPE:  99
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S TTS -  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT   :    
ExpBur          :eebeeeeeebeebeebbbebbbeebebbbbbbbeebbbbbbbbbeeeeee-bebeeebeeeeeeebebbeeeeebebeebeeeebbbbbebeeebeeebe:    
Contact         :                                               bbb                                                  

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
1lvo_D_3     100:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 199
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeebbbbbeebbbeeebeebbbbbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeebeeeebb:    
Contact         :                                                                                   bbb bbbbb        

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
1lvo_D_3     200:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 296
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB     --GGGGHHHHHHHS  HHHHHHHHHH-HHH  TT  BTTBSS    S HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebbeeeebeeeebbebbeeeebeebee--eeebeebbeeeebebeebbbbbbe-beeebeeeebbeeeebbbebbbebbeeee:    

queryA       301:SGVTF: 305
                : **  :
1lvo_D_3     297:YGVNL: 301
SecStr          :H S  :    
ExpBur          :eeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123