#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 1p9u_B_1_A_1

Protein Model on 1p9u_B_1_A_1 (TEMPLATE: 1p9u )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [300 aa] putative coronavirus nsp2 (3CL-PRO) :R1AB_CVPPU
2 b A 1 (A) polymer(polypeptide(L)) [299 aa] putative coronavirus nsp2 (3CL-PRO) :R1AB_CVPPU 1S 2G 4R 5K 6M 7A 8F(Q) 9P 10S 11G 14E 122P 123S(G) 124G(S) 125V 126Y 127Q(G) 128C(V) 137K 138G 139S 140F 141L(I) 166E 170G 172H 277N(G) 278G 283G(S) 284S(Y) 285A(G) 299Q (identity: 68.8 %/45.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1p9u_B_1 identity=45.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *   ** * *         * ***   ** ** :
1p9u_B_1       1:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPE:  99
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S TTS -  HHHHHHT  GGGEEEESSS EE EEEEEEETTEEEEEESS  TT   :    
ExpBur          :eebeeeeeebeebeebbbebbbeebebbbbbbeeebbbbbbbbbeeeeee-bebeebbeebeeeebebbbeeeebebeeeeeeebbbbbebeeebeeebe:    
Contact         :bb bbbbbbbb  b                                                                                      

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
1p9u_B_1     100:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 199
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeebbbbbeebbbeeebeebbbbbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeebeebeeb:    
Contact         :                     bbbbbbb        bbbbb                        b   b b                            

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
1p9u_B_1     200:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 296
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB     --SGGGHHHHHHHS  HHHHHHHHHH-HTT  TT  BTTBSS      HHHHHTTT:    
ExpBur          :bebbbbbbbbbbeeeeeebbeeeebebeebbebbeeeebeebee--eeebeebeeeeebebeebbbbbbe-beeebeeeebbeeeebbbebbbebbbeeb:    
Contact         :                                                                            bb    bbb             b 

queryA       301:SGV: 303
                : **:
1p9u_B_1     297:YGV: 299
SecStr          :S  :    
ExpBur          :eee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123