#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2a5k_A_1_C_1

Protein Model on 2a5k_A_1_C_1 (TEMPLATE: 2a5k )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [304 aa] 3C-like peptidase :R1AB_CVHSA
2 b C 1 (A) non-polymer(AZP) (5S,8S,14R)-ETHYL 11-(3-AMINO-3-OXOPROPYL)-8-BENZYL-14-HYDROXY-5-ISOBUTYL-3,6,9,12-TETRAOXO-1-PHENYL-2-OXA-4,7,10,11-TETRAAZAPENTADECAN-15-OATE 25T 26T 41H 44C 49M 54Y 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 167L 172H 185F 187D 188R 189Q 190T 192Q (identity: 100.0 %/96.1 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2a5k_A_1 identity=96.1%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
2a5k_A_1       2:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 101
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTTTTS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeebebeebeebbbebbbeeeebbbbbbeebbbbbbbbbbeeebeeebebeebbeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :                        bb              b  b    b    b                                              

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
2a5k_A_1     102:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 201
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEEB TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeeeeeeeeeeb:    
Contact         :                                       bbbbbb                 bbbbb    b            b bbbb b        

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
2a5k_A_1     202:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 301
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeebbeebeebbeebebebeebbbbbbebbeeebeeeebbebeebebbbbbebbebee:    

queryA       301:SGVT: 304
                :****:
2a5k_A_1     302:SGVT: 305
SecStr          :HT  :    
ExpBur          :eeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123