#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2alv_A_2_B_2

Protein Model on 2alv_A_2_B_2 (TEMPLATE: 2alv )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 2 (A) polymer(polypeptide(L)) [302 aa] Replicase polyprotein 1ab :R1AB_CVHSA
2 b B 2 (A) non-polymer(CY6) N-((3S,6R)-6-((S,E)-4-ETHOXYCARBONYL-1-((S)-2-OXOPYRROLIDIN-3-YL)BUT-3-EN-2-YLCARBAMOYL)-2,9-DIMETHYL-4-OXODEC-8-EN-3-YL)-5-METHYLISOXAZOLE-3-CARBOXAMIDE 26T 27L 41H 44C 54Y 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 167L 168P 172H 187D 188R 189Q 190T 191A 192Q (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2alv_A_2 identity=96.0%
queryA         2:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKY: 101
                :********************************* ********** ****************** ******************** * ***** *******:
2alv_A_2       2:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKY: 101
SecStr          :         HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  SS SSS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  SE:    
ExpBur          :ebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbebbbeeeeeeebebeebbeeeeeeebebeeeeeebebeeeeeeebbbebebeeebeeebee:    
Contact         :                        bb             b  b         b                                               

queryA       102:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTIT: 201
                :******************************** ********************************************* *********************:
2alv_A_2     102:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTIT: 201
SecStr          :EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS S        B H:    
ExpBur          :eeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeebeebb:    
Contact         :                                      bbbbbb                 bbbbbb   b              bbbbbb         

queryA       202:VNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS: 301
                : **************************************************************** *****************  ***************:
2alv_A_2     202:LNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS: 301
SecStr          :HHHHHHHHHHHHHT  SS  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHH :    
ExpBur          :bbbbbbbbbbbbeeeeebbeeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeeeeebbbbbbbebbeeebe:    

queryA       302:GV: 303
                :**:
2alv_A_2     302:GV: 303
SecStr          :  :    
ExpBur          :ee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123