#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2amp_A_1_C_1

Protein Model on 2amp_A_1_C_1 (TEMPLATE: 2amp )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_CVPPU
2 b C 1 (A) non-polymer(I12) N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]-L-ALANYL-L-VALYL-N~1~-((1S)-4-ETHOXY-4-OXO-1-{[(3S)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 41H 47E(T) 52P(I) 140F 141L(I) 143G 145C 163H 164H 165M(L) 166E 168P(G) 172H 187D 188R(Q) 189Q(P) 190T(S) 191A(M) (identity: 50.0 %/45.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2amp_A_1 identity=45.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *   ** * *         * ***   ** ** :
2amp_A_1       3:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPE: 101
SecStr          :          GGGTTSEEEEEETTEEEEEEEETTEEEEEGGGT S TTS -  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEES   TT   :    
ExpBur          :eebeeeeeebeebeebbbebbbeebebbbbbbeeebbbbbbbbbeeeeee-bebeebeeebeeeebbbbeeeeebebeebeeeebbbbbebeeebeeebe:    
Contact         :                                        b     b    b                                                

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
2amp_A_1     102:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 201
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeebbbbbeebbbebebeeebbbbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeeeebb:    
Contact         :                                       bb b b                 bbbb b   b              bbbbb         

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
2amp_A_1     202:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 298
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB     --GGGGHHHHHHHS  HHHHHHHHHH-HTT  TT  BTTBSS    S HHHHHHHS:    
ExpBur          :bebbbbbbbbbbbeeeeebeeeeeeeeeebbebbeeeebeebee--eeebeebbeebebebeebbbbbbe-beeebeeeebbeeeebbbebbbebbbeeb:    

queryA       301:SGV: 303
                : **:
2amp_A_1     299:YGV: 301
SecStr          :S  :    
ExpBur          :eee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123