#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2q6f_B_1_C_1

Protein Model on 2q6f_B_1_C_1 (TEMPLATE: 2q6f )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [295 aa] Infectious bronchitis virus (IBV) main protease :Q3Y5H1_9CORO
2 b C 1 (D) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 1S (identity: 100.0 %/43.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2q6f_B_1 identity=43.4%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTP:  99
                :*** *   **  ** * * *      ****** *  ******             * *    ** * *   * * * *        ** *    **  **:
2q6f_B_1       3:SGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDSIYCPRHVLG---KFSGDQWGDVLNLANNHEFEVVTQNGVTLNVVSRRLKGAVLILQTAVANAETP:  99
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG ---S  TTHHHHHHHTS GGG EEE SSS EE EEEEEEETTEEEEEESS  TT  :    
ExpBur          :eeeeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbebbe---eeeeeebbeebeebeeeebebebeeeeebebeeeeeeebbbbbebeeebeeee:    
Contact         :b                                                                                                   

queryA       100:KYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :*****    *  *     * *   * *   ** * **  *** * ********    * * **** ***   * **** * ***  **   **    *  :
2q6f_B_1     100:KYKFVKANCGDSFTIACSYGGTVIGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMGEFYGGYVDEEVAQRVPPDNL: 199
SecStr          :SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEETTTEEEEE TTS BGGG  SSSS        B:    
ExpBur          :eeebbebeebeebbbbbbeebebeeebebbbbebbbbeeebeeebbbbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeeeeeeeeee:    

queryA       200:ITVNVLAWLYAAVIN-------GDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRT--ILGSALLEDE: 290
                : * *  ****** *           * *   *    * *  *      *           *** **    * *  *              ***    ***:
2q6f_B_1     200:VTNNIVAWLYAAIISVXXXXXXXPKW-LESTTVSIEDYNRWASDNGFTPFSTSTA--ITKLSAITGV---DVCKLLRTIMVKSAQWGSDPILGQYNFEDE: 293
SecStr          : HHHHHHHHHHHHHH ------- TT-  SS   HHHHHHHHHHHTB      HH--HHHHHHHH  --- HHHHHHHHHHHHH   S  BTTBSS   S:    
ExpBur          :bbbbbbbbbbbbbeee-------eeb-eeeeebeeeebeeebeeeebbebeebeb--beebeeeeeb---ebbebbebbbebeeebeeeebeeeeebbbb:    

queryA       291:FTPFDVVRQ: 299
                : **  *  *:
2q6f_B_1     294:LTPESVFNQ: 302
SecStr          :S HHHHHHT:    
ExpBur          :bbbebbeeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123