#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2q6g_A_1_C_1

Protein Model on 2q6g_A_1_C_1 (TEMPLATE: 2q6g )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [305 aa] severe acute respiratory syndrome coronavirus (SARS-CoV) :R1AB_CVHSA
2 b C 1 (C) polymer(polypeptide(L)) [11 aa] Polypeptide chain 21T 24T 25T 26T 49M 54Y 67L 69Q 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 168P 172H 187D 189Q 190T 191A (identity: 100.0 %/95.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2q6g_A_1 identity=95.7%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ***** **** ****************** ******************** * ***** ******:
2q6g_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRAVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TT  SS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeebebeebebbbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebeeeeeebebebeeeeebbbebebeeebeeebe:    
Contact         :                    b  bbb                      b    b            b b                               

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
2q6g_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeeeeeb:    
Contact         :                                       bbbbbb                 bbbb b   b              b bbb         

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
2q6g_A_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHT  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebebeebeebbeeeebeebeeebbeebeebbeeeebebeebbbbbbebbeeebeeeebbeeeebebbbbbebbebbe:    

queryA       301:SGVTF: 305
                :*****:
2q6g_A_1     301:SGVTF: 305
SecStr          :TT   :    
ExpBur          :eeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123