#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2zu2_A_1_B_1

Protein Model on 2zu2_A_1_B_1 (TEMPLATE: 2zu2 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1A_CVH22
2 b B 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVH22 1S(A) 2G 4R 5K 6M 7A 9P 10S 11G 14E 122P(A) 123S(Q) 124G 125V 126Y(F) 127Q(G) 128C(V) 137K(R) 138G 139S 140F 141L(I) 166E 172H 282L 285A(S) 286L(S) 290E 298R(K) 299Q 300C(M) 301S(F) 302G (identity: 60.6 %/41.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2zu2_A_1 identity=41.9%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTP:  99
                : * **** *** ** * * *  * * ****** * ********            *    *   ***    *   * * *  *    ** **   *  **:
2zu2_A_1       1:AGLRKMAQPSGFVEKCVVRVCYGNTVLNGLWLGDIVYCPRHVIASNTTSAIDYDHEYSIMRL--HNFSIISGTAFLGVVGATMHGVTLKIKVSQTNMHTP:  98
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG S  SS   HHHHHHH  G--GGEEEEETTEEE EEEEEEETTEEEEEESS  TT  :    
ExpBur          :eebeeeeeebeebeebbbebbbeeeebbbbbbeeebbbbbebbbeeeeeebebeebeeebee--eebebbeeeeebeeeebeeeebbbbbebeeebeeeb:    
Contact         :bb bbbb bbb  b                                                                                      

queryA       100:KYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :   *     *  *  **** *   **    ** * ** *** ** *** * *     * * ***  **  * * *    *  ** * *    *       :
2zu2_A_1      99:RHSFRTLKSGEGFNILACYDGCAQGVFGVNMRTNWTIRGSFINGACGSPGYNLKNGEVEFVYMHQIELGSGSHVGSSFDGVMYGGFEDQPNLQVESANQM: 198
SecStr          :SEEE    TT EEEEEEESSSSEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B:    
ExpBur          :eeeeeebeebeebbbbbbeebeeeeeebbbbebbebbebebeeebbbbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeeeee:    
Contact         :                      bbbbbbb        bbbbb                        b     b                           

queryA       200:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ: 299
                : **** * ****  **  * *          *  *             *    * * **  *          * **  *  ***   * ***    ** *:
2zu2_A_1     199:LTVNVVAFLYAAILNGCTWWLKGEKLFVEHYNEWAQANGFTAMNGE--DAFSILAAKTGVCVERLLHAI-QVLNNGFGGKQILGYSSLNDEFSINEVVKQ: 295
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB     G--GGGHHHHHHHT  HHHHHHHH-HHHTT  TT  BTTBSS      HHHHHHH:    
ExpBur          :bbebbbbbbbbbbebebeebeeeeebebeebeebbeeeebbebeee--eebeebbeebebbbeebbbbb-eebeeebeeeebeeeeebbbebbbebbbee:    
Contact         :                                                                                  b  bb   b       bb

queryA       300:CSGV: 303
                :  **:
2zu2_A_1     296:MFGV: 299
SecStr          :HH  :    
ExpBur          :beee:    
Contact         :bbb                                                                                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123