#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2zu2_A_1_D_1

Protein Model on 2zu2_A_1_D_1 (TEMPLATE: 2zu2 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1A_CVH22
2 b D 1 (A) non-polymer(DTZ) zinc(II)hydrogensulfide 41H 145C (identity: 100.0 %/41.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2zu2_A_1 identity=41.9%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTP:  99
                : * **** *** ** * * *  * * ****** * ********            *    *   ***    *   * * *  *    ** **   *  **:
2zu2_A_1       1:AGLRKMAQPSGFVEKCVVRVCYGNTVLNGLWLGDIVYCPRHVIASNTTSAIDYDHEYSIMRL--HNFSIISGTAFLGVVGATMHGVTLKIKVSQTNMHTP:  98
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG S  SS   HHHHHHH  G--GGEEEEETTEEE EEEEEEETTEEEEEESS  TT  :    
ExpBur          :eebeeeeeebeebeebbbebbbeeeebbbbbbeeebbbbbebbbeeeeeebebeebeeebee--eebebbeeeeebeeeebeeeebbbbbebeeebeeeb:    
Contact         :                                        b                                                           

queryA       100:KYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :   *     *  *  **** *   **    ** * ** *** ** *** * *     * * ***  **  * * *    *  ** * *    *       :
2zu2_A_1      99:RHSFRTLKSGEGFNILACYDGCAQGVFGVNMRTNWTIRGSFINGACGSPGYNLKNGEVEFVYMHQIELGSGSHVGSSFDGVMYGGFEDQPNLQVESANQM: 198
SecStr          :SEEE    TT EEEEEEESSSSEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B:    
ExpBur          :eeeeeebeebeebbbbbbeebeeeeeebbbbebbebbebebeeebbbbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeeeee:    
Contact         :                                             b                                                      

queryA       200:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ: 299
                : **** * ****  **  * *          *  *             *    * * **  *          * **  *  ***   * ***    ** *:
2zu2_A_1     199:LTVNVVAFLYAAILNGCTWWLKGEKLFVEHYNEWAQANGFTAMNGE--DAFSILAAKTGVCVERLLHAI-QVLNNGFGGKQILGYSSLNDEFSINEVVKQ: 295
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB     G--GGGHHHHHHHT  HHHHHHHH-HHHTT  TT  BTTBSS      HHHHHHH:    
ExpBur          :bbebbbbbbbbbbebebeebeeeeebebeebeebbeeeebbebeee--eebeebbeebebbbeebbbbb-eebeeebeeeebeeeeebbbebbbebbbee:    

queryA       300:CSGV: 303
                :  **:
2zu2_A_1     296:MFGV: 299
SecStr          :HH  :    
ExpBur          :beee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123