#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2zu2_B_1_C_1

Protein Model on 2zu2_B_1_C_1 (TEMPLATE: 2zu2 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVH22
2 b C 1 (A) non-polymer(MPD) (4S)-2-METHYL-2,4-PENTANEDIOL 1S(A) (identity: 0.0 %/41.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2zu2_B_1 identity=41.7%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTP:  99
                : * **** *** ** * * *  * * ****** * ********            *    *   ***    *   * * *  *    ** **   *  **:
2zu2_B_1       1:AGLRKMAQPSGFVEKCVVRVCYGNTVLNGLWLGDIVYCPRHVIASNTTSAIDYDHEYSIMRL--HNFSIISGTAFLGVVGATMHGVTLKIKVSQTNMHTP:  98
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG S SSS   HHHHHHT  G--GGEEEEETTEEE EEEEEEETTEEEEEES   TT  :    
ExpBur          :eebeeeeeebeebeebbbebbbeeeebbbbbbeebbbbbbebbbeeeeeebebeebeeebee--eebebbeeeeebeeeebeeeebbbebebeeebeeeb:    
Contact         :b                                                                                                   

queryA       100:KYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :   *     *  *  **** *   **    ** * ** *** ** *** * *     * * ***  **  * * *    *  ** * *    *       :
2zu2_B_1      99:RHSFRTLKSGEGFNILACYDGCAQGVFGVNMRTNWTIRGSFINGACGSPGYNLKNGEVEFVYMHQIELGSGSHVGSSFDGVMYGGFEDQPNLQVESANQM: 198
SecStr          :SEEE    TT EEEEEEESSSSEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B:    
ExpBur          :eeeeeebeebeebbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeeeee:    

queryA       200:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ: 299
                : **** * ****  **  * *          *  *             *    * * **  *          * **  *  ***   * ***    ** *:
2zu2_B_1     199:LTVNVVAFLYAAILNGCTWWLKGEKLFVEHYNEWAQANGFTAMNGE--DAFSILAAKTGVCVERLLHAI-QVLNNGFGGKQILGYSSLNDEFSINEVVKQ: 295
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB      --HHHHHHHHHHS  HHHHHHHH-HHHTT  TT  BTTBSS      HHHHHHH:    
ExpBur          :bbebbbbbbbbbbeeebeebeeeeebebeebeebbeeeebbebeee--ebbeebbeeeebebeebbebb-eebeeebeeeebeeeeebbbebbbebbbee:    

queryA       300:CSGVTF: 305
                :  **  :
2zu2_B_1     296:MFGVNL: 301
SecStr          :HH    :    
ExpBur          :eeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123