#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3d23_A_1_D_1

Protein Model on 3d23_A_1_D_1 (TEMPLATE: 3d23 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1AB_CVHN1
2 b D 1 (D) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_CVHN1 34D 72N(R) 74Q(S) 92D(S) 93T(L) 94A(Q) 95N 96P (identity: 37.5 %/49.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3d23_A_1 identity=49.7%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :**  **  *  * * * * ** *  ********* ********* *  *  * *  ** *     *    *   * *    ** * * * *   ** ***:
3d23_A_1       3:SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCRVTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPK: 102
SecStr          : S        TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG  SSSTTS  HHHHHHH  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeeeeeeebeebbbbbebeebebbbbbbeeebbbbbbbbbeeeeeeebebeebeeebeeeebebeeeeeebebeeeeeeebbbbbbbeeebeeebe:    
Contact         :                                 b                                     b b                 bbbbb    

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :* *    ** ** *** *** * *     **   ******* *******     * * * ***  ** ** * ***  ******  * *  *    *   :
3d23_A_1     103:YTFGNVKPGETFTVLAAYNGRPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGNFYGPYRDAQVVQLPVKDYVQ: 202
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEE  TT EEEEEEEEEEEETTEEEEE TTS BSTT  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbebeeebbebbbbbbbebeeebbbbbbbebebbeebebbeeebeeeeeeeb:    

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :**** ******  *   **         ***  **         * *  *  *   **       *  * *   *  ** ****   ***  * **  * :
3d23_A_1     203:TVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFSQVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL: 299
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB      HH--HHHHHHHHS  HHHHHHHHHHHHT-  TT  BTTBSS   SS HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeebeebeeeeebeeeebbebbeeeebbebeeeee--beebbeebebebebbbbbbeebee-ebeeeebeebeebebebbbebbeeee:    

queryA       301:SGV: 303
                : **:
3d23_A_1     300:AGV: 302
SecStr          :H  :    
ExpBur          :eee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123