#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3d23_D_2_A_1

Protein Model on 3d23_D_2_A_1 (TEMPLATE: 3d23 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) D 2 (D) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_CVHN1
2 b A 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1AB_CVHN1 1S 2G 4R(V) 5K 6M 7A(V) 9P 10S(T) 11G(S) 14E 121S(R) 123S(Q) 124G 125V(A) 126Y(F) 137K 138G 139S 141L 169T 170G 171V(C) 215G(N) 280T(Q) 285A(C) 286L(T) 298R(Q) 299Q 300C(L) (identity: 48.3 %/49.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3d23_D_2 identity=49.5%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :**  **  *  * * * * ** *  ********* ********* *  *  * *  ** *     *    *   * *    ** * * * *   ** ***:
3d23_D_2       3:SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCRVTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPK: 102
SecStr          :-         TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG  GGGSSS  HHHHGGG  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :-eeeeeeeeeeebeebbbbbbbeeeebbbbbbeeebbbbbbbbbeeeeeeebebeebeeebeeeebebebeeeebebeeeeeeebbbbbbbeeebeeebe:    
Contact         :bb bbbb bbb  b                                                                                      

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :* *    ** ** *** *** * *     **   ******* *******     * * * ***  ** ** * ***  ******  * *  *    *   :
3d23_D_2     103:YTFGNVKPGETFTVLAAYNGRPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGNFYGPYRDAQVVQLPVKDYVQ: 202
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS        B :    
ExpBur          :eeebebeebebbbbbbbbebeeeeeebbbbbebebbeeebeeebbbbbbbeeeeebbebbbbbbbebeeebbbbbbbebebbeebebbeeebeeeeeeeb:    
Contact         :                    b bbbb          bbb b                           bbb                             

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :**** ******  *   **         ***  **         * *  *  *   **       *  * *   *  ** ****   ***  * **  * :
3d23_D_2     203:TVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFSQVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL: 299
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB      HH--HHHHHHHHS  HHHHHHHHHHHTT-  TT  SSS SS   SS HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebbebeeeee--beebbeeeebebebbbbbbeebee-ebeeeebeeeeebebebbbebbeeee:    
Contact         :              b                                                                b    bb           bbb

queryA       301:SG: 302
                : *:
3d23_D_2     300:AG: 301
SecStr          :T :    
ExpBur          :ee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123