#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3d62_A_1_B_1

Protein Model on 3d62_A_1_B_1 (TEMPLATE: 3d62 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_CVHSA
2 b B 1 (A) non-polymer(959) benzyl (2-oxopropyl)carbamate 41H 49M 142N 143G 144S 145C 164H 165M 188R 189Q (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3d62_A_1 identity=96.0%
queryA         3:FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYK: 102
                :******************************** ********** ****************** ******************** * ***** ********:
3d62_A_1       1:FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYK: 100
SecStr          :        HHHHTTEEEEEETTEEEEEEEETTEEE BGGGS  GGGSSS  HHHHHHH  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT   EE:    
ExpBur          :eeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebebeeeebebeeeeebebbbebebeeebeeebeee:    
Contact         :                                      b       b                                                     

queryA       103:FVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITV: 202
                :******************************* ********************************************* ********************* :
3d62_A_1     101:FVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITL: 200
SecStr          :E    TT EEEEEEESSSSEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS S        B HH:    
ExpBur          :eeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbebeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebbbbe:    
Contact         :                                       bbbb                  bb                      bb             

queryA       203:NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS: 301
                :**************************************************************** *****************  ***************:
3d62_A_1     201:NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS: 299
SecStr          :HHHHHHHHHHHTT  TT  S    STTHHHHHHHTTB    HHHHHTTHHHHHHHT  HHHHHHHHHHHHHT   S  SSS SS      SHHHHTT  :    
ExpBur          :bbbbbbbbbbeeeeeebebeeebebeebeebbeeeebeebeeeebeebeebbeeeeeebeebbbbbeebbeeeeeeeebeeeeeebbbbbbebbeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123