#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3ebn_B_1_D_1

Protein Model on 3ebn_B_1_D_1 (TEMPLATE: 3ebn )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [100 aa] Replicase polyprotein 1ab :R1AB_CVHSA
2 b D 1 (D) polymer(polypeptide(L)) [101 aa] Replicase polyprotein 1ab :R1AB_CVHSA 198T 199T 200I 201T 202V(L) 203N 204V 205L 206A 207W 208L 209Y 210A 211A 212V 213I 214N 216D 218W 219F 220L 221N 222R 223F 230F 238N 239Y 240E 242L 246H 250L 253L 254S 256Q 257T 259I 260A 261V 264M 265C 267S(A) 268L 270E 271L 273Q 274N 279R 280T 281I 282L 284S 286L(I) 287L 288E 289D 291F 292T 293P 296V (identity: 94.9 %/96.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3ebn_B_1 identity=96.0%
queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVV: 297
                :**** **************************************************************** *****************  ***********:
3ebn_B_1      10:TTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVV: 109
SecStr          :   HHHHHHHHHHHHHTT  GGGS     HHHHHHHHHHTT     HHHHHHTHHHHHHH   HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHH :    
ExpBur          :eeeeeeeeeeeeebeeeeeeeeeeeeebebeebbebbeeeeeeebeeeebeeeeebbeeeeeebeeebbeebbebeeebeeeeeeeeeeeeeeeeeeeee:    
Contact         :bbbbbbbbbbbbbbbbb b bbbbbb      b       bbb b   b   b  bb bb bbb  bb bb bb bb    bbbb b bbbb bbb  b 


Input Residue Numbers for Focused Sites

ex) 2,15,123