#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3iwm_B_1_D_1

Protein Model on 3iwm_B_1_D_1 (TEMPLATE: 3iwm )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA
2 b D 1 (D) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1A_CVHSA 3F 4R 5K 6M 8F 109G 110Q 111T 127Q 128C 129A 131R 132P 197D 198T 199T 200I 201T 202V(L) 203N 204V 205L 206A 207W 208L 209Y 210A 211A 212V 213I 216D 218W 219F 220L 221N 222R 223F 224T 230F 238N 239Y 240E 242L 246H 249I 250L 253L 254S 256Q 257T 259I 260A 261V 263D 264M 265C 266A 267S(A) 268L 270E 279R 280T 281I 282L 283G 286L(I) 287L 288E 289D 290E 291F 292T 293P 295D 296V 298R 299Q 300C (identity: 96.2 %/96.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3iwm_B_1 identity=96.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
3iwm_B_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :         THHHHTTEEEEESSS EEEEEEETTEEE  TTSS  SSSSSS  HHHHBSSS TTS EEEETTEEEEEEEEEE SSSEEEEESS  TT  E:    
ExpBur          :eeeeeeeeebeebeebbbebbbeeeebbbbbbeebbbbbbebbbeeeeeeebebeebbeebeeeebebbeeeeebebebeeeeebbbebebeeebeeebe:    
Contact         :  bbbb b                                                                                            

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
3iwm_B_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT  EEEEEEETTEEEEEEEE B TTS B     TT TT EEE EETTEEEE EEEEE  TTS BEEE TT  BSSS  SSSSS         :    
ExpBur          :eebeebeebeebbbbbbeebeeeeeebbebbebebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeee:    
Contact         :        bbb               bbb bb                                                                bbbb

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
3iwm_B_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHTTT  TT       HHHHHHHHHHTT     HHHHHHHHHHHHHTT  HHHHHHHHHHHHTT  SS  BTTBSS      HHHHHHH :    
ExpBur          :eeeeeeeeebbeeeeeeeeeeeeebeeeebbebbeeeeeeebeeeebeeeeeeeeeeeeebeeebbeebeebeeebeeeeeeebeeeeeeeeeeeeeeee:    
Contact         :bbbbbbbbbbbbb  b bbbbbbb     b       bbb b   b  bb  bb bb bbb bbbbbb b        bbbbb  bbbbbbbb bb bbb

queryA       301:S: 301
                :*:
3iwm_B_1     301:S: 301
SecStr          : :    
ExpBur          :e:    


Input Residue Numbers for Focused Sites

ex) 2,15,123