#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3iwm_C_1_B_2

Protein Model on 3iwm_C_1_B_2 (TEMPLATE: 3iwm )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) C 1 (C) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1A_CVHSA
2 b B 2 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA 123S 124G 139S 141L (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3iwm_C_1 identity=96.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
3iwm_C_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :         SHHHHTTEEEEE SS EEEEEEETTEEE  TTTT  TTS SS  SSSSTTTS GGG EEEETTEEE    EEEETTEEEEE SS  TT  S:    
ExpBur          :eeeeeeeeebeebeebbbebbbeebebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebeeeeeebebeebeeeebbbebebeeebeeebe:    

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
3iwm_C_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEE STT EEEEEEEEEE TTS EEEE TTS BSSS  SS SS         :    
ExpBur          :eeeeebeebeebbbbbbbebeeeeeebbebbebebbeeebeebbbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeeeeeb:    
Contact         :                      bb              b b                                                           

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
3iwm_C_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  GGGS     STTTGGGHHHH      HHHHHHHHHHHHHHT  HHHHHHHHHHHHTT  TT  BTTBSS   S  TTHHHHH :    
ExpBur          :eeeeeeeeebbbeeeeeeeeeeeebeeeebbebbeeeeeeebeeeebeeeeebeeeeeeebeeebbebbeebeeebeeeeeeebeeeeeeeeeeeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123