#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3tlo_A_1_E_1

Protein Model on 3tlo_A_1_E_1 (TEMPLATE: 3tlo )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [302 aa] 3C-like proteinase :R1A_CVHNL
2 b E 1 (A) non-polymer(GOL) GLYCEROL 202V(D) 243T(S) 249I(C) 250L(Y) 305F(L) (identity: 0.0 %/44.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3tlo_A_1 identity=44.9%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :**  *** *** ** * * *  * * *** ** * * ******  *   *   *         *** *    * * * *  *   **  **   *  ***:
3tlo_A_1       1:SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYSTMRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPK:  99
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  S SS -  HHHHHHH  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eeeebeeeebeebeebbbebbbeeeebbbbbbeeebbbbbebbbeeeeee-bebeebeeebeeeebebbbeeeebeeeebebeebbbebebeeebeeebe:    

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :  *    **  *  **** *  ***     * ******** ** *** * *   *  * *** *  **  * * * *  *  ** * *    *       :
3tlo_A_1     100:HVFKTLKPGDSFNILACYEGIASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTGSVYGNFDDQPSLQVESANLM: 199
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEE TTS EEEEEEEEEE TTS EEEE TTS BGGG  SSS         B:    
ExpBur          :eeeeebeeeeebbbbbbeebeeeeeebbbbeebebbeeebeeebbbbbbbbeeeeebbbbbbbbbbebeeebbbbbbbebebbeebebbeeeeebeeeee:    

queryA       200:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ: 299
                :   ** * ****  ** ** *         **  **   *       *     * * **  *    **    *  *  *  ***   * ****   ** *:
3tlo_A_1     200:LSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGYTSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ: 296
SecStr          : HHHHHHHHHHHHHTT  TT       HHHHHHHHHHHTB     --SGGGHHHHHHHT  HHHHHHHHHH-HTT  TT  BTTBSS      HHHHHHH:    
ExpBur          :bbebbbbbbbbbbeeebeebebeeebebeebbebbeeeebbebee--beebeebeeebebebeebbbbbee-beeebeeeebeeeeebbbebbbebbbee:    
Contact         :  b                                        b     bb                                                 

queryA       300:CSGVTF: 305
                :  **  :
3tlo_A_1     297:MYGVNL: 302
SecStr          :HHS   :    
ExpBur          :eeeeee:    
Contact         :     b                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123