#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4f49_B_1_F_1

Protein Model on 4f49_B_1_F_1 (TEMPLATE: 4f49 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [297 aa] 3C-like proteinase :R1A_CVPPU
2 b F 1 (B) non-polymer(K36) (1S,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino)-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid 41H 47E(T) 140F 141L(I) 142N(A) 143G 144S(T) 145C 163H 164H 165M(L) 166E 172H 187D 188R(Q) 189Q(P) (identity: 56.2 %/45.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4f49_B_1 identity=45.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *   ** * *         * ***   ** ** :
4f49_B_1       8:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPE: 106
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S TTS -  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeeeebeebeebbbebbbeebebbbbbbeeebbbbbbbbbeeeebe-bebeebeeebbeeebebebeeeebebeeeeeeebbbbbebeeebeeebe:    
Contact         :                                        b     b                                                     

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
4f49_B_1     107:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 206
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeebbbbbeebbbebebeeebbbbbbbbeeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebebeeeebb:    
Contact         :                                       bbbbbb                 bbbb     b              bbb           

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
4f49_B_1     207:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSX--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 303
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    --- GGGHHHHHHHS  HHHHHHHHHH-HTT  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bebbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebe---eeebeebbeebebebeebbbbbbe-beeebeeeebbeeeebbbebbbebbeeee:    

queryA       301:SG: 302
                : *:
4f49_B_1     304:YG: 305
SecStr          :H :    
ExpBur          :ee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123